ZNF330

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF330
Ідентифікатори
Символи ZNF330, HSA6591, NOA36, zinc finger protein 330
Зовнішні ІД OMIM: 609550 MGI: 1353574 HomoloGene: 8714 GeneCards: ZNF330
Шаблон експресії
PBB GE ZNF330 213760 s at fs.png

PBB GE ZNF330 209814 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001292002
NM_014487
NM_145600
RefSeq (білок)
NP_001278931
NP_055302
NP_663575
NP_001355272
NP_001355273
NP_001355274
NP_001355275
Локус (UCSC) Хр. 4: 141.22 – 141.23 Mb Хр. 8: 82.76 – 82.77 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF330 (англ. Zinc finger protein 330) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 320 амінокислот, а молекулярна маса — 36 201[4].

Послідовність амінокислот
1020304050
MPKKKTGARKKAENRREREKQLRASRSTIDLAKHPCNASMECDKCQRRQK
NRAFCYFCNSVQKLPICAQCGKTKCMMKSSDCVIKHAGVYSTGLAMVGAI
CDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHGGRIFSCSFCH
NFLCEDDQFEHQASCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRS
KVFKQEKGKQPPCPKCGHETQETKDLSMSTRSLKFGRQTGGEEGDGASGY
DAYWKNLSSDKYGDTSYHDEEEDEYEAEDDEEEEDEGRKDSDTESSDLFT
NLNLGRTYASGYAHYEEQEN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі як поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі, хромосомах, центромерах.

Література[ред. | ред. код]

  • Bolivar J., Diaz I., Iglesias C., Valdivia M.M. (1999). Molecular cloning of a zinc finger autoantigen transiently associated with interphase nucleolus and mitotic centromeres and midbodies. Orthologous proteins with nine CXXC motifs highly conserved from nematodes to humans.. J. Biol. Chem. 274: 36456 — 36464.  PubMed DOI:10.1074/jbc.274.51.36456
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15462 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9Y3S2 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]