TBX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TBX2
Protein TBX2 PDB 1h6f.png
Ідентифікатори
Символи TBX2, T-box 2, VETD, T-box transcription factor 2
Зовнішні ІД OMIM: 600747 MGI: 98494 HomoloGene: 38123 GeneCards: TBX2
Шаблон експресії
PBB GE TBX2 213417 at fs.png

PBB GE TBX2 40560 at fs.png

PBB GE TBX2 205993 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005994
NM_009324
RefSeq (білок)
NP_005985
NP_033350
Локус (UCSC) Хр. 17: 61.4 – 61.41 Mb Хр. 11: 85.83 – 85.84 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TBX2 (англ. T-box 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 712 амінокислот, а молекулярна маса — 75 066[4].

Послідовність амінокислот
1020304050
MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAK
PLPDPGLAGAAAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDE
VEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAK
YILLMDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWM
AKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTF
RTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLT
LPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRAR
AEEKSCAADSDPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERR
SPERGKEPAESGGDGPFGLRSLEKERAEARRKDEGRKEAAEGKEQGLAPL
VVQTDSASPLGAGHLPGLAFSSHLHGQQFFGPLGAGQPLFLHPGQFTMGP
GAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPAASAASTAAPF
PFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAA
AAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAG
GNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLES
QRALSPGRESPK

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Campbell C., Goodrich K., Casey G., Beatty B. (1995). Cloning and mapping of a human gene (TBX2) sharing a highly conserved protein motif with the Drosophila omb gene.. Genomics 28: 255 — 260.  PubMed DOI:10.1006/geno.1995.1139
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Law D.J., Gebuhr T., Garvey N., Agulnik S.I., Silver L.M. (1995). Identification, characterization, and localization to chromosome 17q21-22 of the human TBX2 homolog, member of a conserved developmental gene family.. Mamm. Genome 6: 793 — 797.  PubMed DOI:10.1007/BF00539006

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11597 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q13207 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]