PAX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PAX2
Protein PAX2 PDB 1k78.png
Ідентифікатори
Символи PAX2, PAPRS, FSGS7, paired box 2
Зовнішні ІД OMIM: 167409 MGI: 97486 HomoloGene: 2968 GeneCards: PAX2
Пов'язані генетичні захворювання
renal coloboma syndrome, focal segmental glomerulosclerosis 7[1]
Шаблон експресії
PBB GE PAX2 206229 x at fs.png

PBB GE PAX2 206228 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011037
RefSeq (білок)
Локус (UCSC) Хр. 10: 100.74 – 100.83 Mb Хр. 19: 44.76 – 44.84 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PAX2 (англ. Paired box 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 417 амінокислот, а молекулярна маса — 44 706[5].

Послідовність амінокислот
1020304050
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVR
PCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIA
EYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRTKVQQPFHPT
PDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEK
RKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKH
LRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL
DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ
GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSA
APRGSAPAAAAAAYDRH

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Stapleton P., Weith A., Urbanek P., Kozmik Z., Busslinger M. (1993). Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9.. Nat. Genet. 3: 292 — 298.  PubMed DOI:10.1038/ng0493-292
  • Gelb A.C., Manligas G.S., Gharaybeh S., Schimmenti L.A. (2001). Identification of two novel polymorphisms (g.903C>T and g.1544C>T) in the PAX2 gene.. Hum. Mutat. 17: 155 — 155.  PubMed DOI:10.1002/1098-1004(200102)17:2<155::AID-HUMU16>3.0.CO;2-9
  • Higashide T., Wada T., Sakurai M., Yokoyama H., Sugiyama K. (2005). Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation.. Am. J. Ophthalmol. 139: 203 — 205.  PubMed DOI:10.1016/j.ajo.2004.07.021
  • Ward T.A., Nebel A., Reeve A.E., Eccles M.R. (1994). Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene.. Cell Growth Differ. 5: 1015 — 1021.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]