YY1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
YY1
Protein YY1 PDB 1ubd.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи YY1, DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1, YY1 transcription factor, GADEVS
Зовнішні ІД OMIM: 600013 MGI: 99150 HomoloGene: 2556 GeneCards: YY1
Шаблон експресії
PBB GE YY1 201902 s at fs.png

PBB GE YY1 201901 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003403
NM_009537
RefSeq (білок)
NP_003394
NP_033563
Локус (UCSC) Хр. 14: 100.24 – 100.28 Mb Хр. 12: 108.79 – 108.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

YY1 (англ. YY1 transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 414 амінокислот, а молекулярна маса — 44 713[4].

Послідовність амінокислот
1020304050
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD
DEDGGGGDHGGGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHH
QEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTL
VTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADP
GNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPD
YSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE
KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNL
KSHILTHAKAKNNQ

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, рекомбінація ДНК, диференціація клітин, сперматогенез. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Shi Y., Seto E., Chang L.-S., Shenk T. (1991). Transcriptional repression by YY1, a human GLI-Kruppel-related protein, and relief of repression by adenovirus E1A protein.. Cell 67: 377 — 388.  PubMed DOI:10.1016/0092-8674(91)90189-6
  • Park K., Atchison M. (1991). Isolation of a candidate repressor/activator, NF-E1 (YY-1, delta), that binds to the immunoglobulin kappa 3' enhancer and the immunoglobulin heavy-chain mu E1 site.. Proc. Natl. Acad. Sci. U.S.A. 88: 9804 — 9808.  PubMed DOI:10.1073/pnas.88.21.9804
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kalenik J.L., Chen D., Bradley M.E., Chen S.-J., Lee T.-C. (1997). Yeast two-hybrid cloning of a novel zinc finger protein that interacts with the multifunctional transcription factor YY1.. Nucleic Acids Res. 25: 843 — 849.  PubMed DOI:10.1093/nar/25.4.843
  • Oei S.L., Shi Y. (2001). Poly(ADP-ribosyl)ation of transcription factor Yin Yang 1 under conditions of DNA damage.. Biochem. Biophys. Res. Commun. 285: 27 — 31.  PubMed DOI:10.1006/bbrc.2001.5115
  • Satijn D.P.E., Hamer K.M., den Blaauwen J., Otte A.P. (2001). The polycomb group protein EED interacts with YY1, and both proteins induce neural tissue in Xenopus embryos.. Mol. Cell. Biol. 21: 1360 — 1369.  PubMed DOI:10.1128/MCB.21.4.1360-1369.2001

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12856 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P25490 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]