TAF15

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF15
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи TAF15, Npl3, RBP56, TAF2N, TAFII68, TATA-box binding protein associated factor 15
Зовнішні ІД OMIM: 601574 MGI: 1917689 HomoloGene: 131088 GeneCards: TAF15
Шаблон експресії
PBB GE TAF15 202840 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003487
NM_139215
NM_027427
RefSeq (білок)
NP_003478
NP_631961
н/д
Локус (UCSC) Хр. 17: 35.71 – 35.86 Mb Хр. 11: 83.47 – 83.51 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF15 (англ. TATA-box binding protein associated factor 15) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 592 амінокислот, а молекулярна маса — 61 830[4].

Послідовність амінокислот
1020304050
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNY
SGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGG
RAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYH
SQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTG
SSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQV
GEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRG
GDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYG
GERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDR
SGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGG
YGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYG
GDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК, РНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Morohoshi F., Arai K., Takahashi E., Tanigami A., Ohki M. (1996). Cloning and mapping of a human RBP56 gene encoding a putative RNA binding protein similar to FUS/TLS and EWS proteins.. Genomics 38: 51 — 57.  PubMed DOI:10.1006/geno.1996.0591
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang D., Paley A.J., Childs G. (1998). The transcriptional repressor ZFM1 interacts with and modulates the ability of EWS to activate transcription.. J. Biol. Chem. 273: 18086 — 18091.  PubMed DOI:10.1074/jbc.273.29.18086
  • Jobert L., Argentini M., Tora L. (2009). PRMT1 mediated methylation of TAF15 is required for its positive gene regulatory function.. Exp. Cell Res. 315: 1273 — 1286.  PubMed DOI:10.1016/j.yexcr.2008.12.008
  • Bertolotti A., Lutz Y., Heard D.J., Chambon P., Tora L. (1996). hTAF(II)68, a novel RNA/ssDNA-binding protein with homology to the pro-oncoproteins TLS/FUS and EWS is associated with both TFIID and RNA polymerase II.. EMBO J. 15: 5022 — 5031.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11547 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q92804 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]