HOXA9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXA9
Protein HOXA9 PDB 1puf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HOXA9, ABD-B, HOX1, HOX1.7, HOX1G, homeobox A9
Зовнішні ІД OMIM: 142956 MGI: 96180 HomoloGene: 7766 GeneCards: HOXA9
Шаблон експресії
PBB GE HOXA9 214651 s at fs.png

PBB GE HOXA9 209905 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_152739
NM_001277238
NM_010456
RefSeq (білок)
NP_689952
NP_001264167
NP_034586
Локус (UCSC) Хр. 7: 27.16 – 27.18 Mb Хр. 6: 52.22 – 52.23 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXA9 (англ. Homeobox A9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 272 амінокислот, а молекулярна маса — 30 172[4].

Послідовність амінокислот
1020304050
MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPD
FSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAA
AAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTH
TLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANW
LHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQV
KIWFQNRRMKMKKINKDRAKDE

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Patel C.V., Sharangpani R., Bandyopadhyay S., DiCorleto P.E. (1999). Endothelial cells express a novel, tumor necrosis factor-alpha-regulated variant of HOXA9.. J. Biol. Chem. 274: 1415 — 1422.  PubMed DOI:10.1074/jbc.274.3.1415
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5109 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P31269 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]