NFKB1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFKB1
Protein NFKB1 PDB 1bfs.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFKB1, EBP-1, KBF1, NF-kB1, NF-kappa-B, NF-kappaB, NFKB-p105, NFKB-p50, NFkappaB, p105, p50, CVID12, nuclear factor kappa B subunit 1, NF-kappa-B1, NF-kB
Зовнішні ІД OMIM: 164011 MGI: 97312 HomoloGene: 2971 GeneCards: NFKB1
Пов'язані генетичні захворювання
шизофренія[1]
Шаблон експресії
PBB GE NFKB1 209239 at.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001165412
NM_003998
NM_001319226
NM_008689
RefSeq (білок)
NP_001158884
NP_001306155
NP_003989
NP_001158884.1
NP_001306155.1
NP_032715
Локус (UCSC) Хр. 4: 102.5 – 102.62 Mb Хр. 3: 135.58 – 135.69 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFKB1 (англ. Nuclear factor kappa B subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 968 амінокислот, а молекулярна маса — 105 356[5].

Послідовність амінокислот
1020304050
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQP
KQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLV
TNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVF
ETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAA
LQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNL
KIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYY
PEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGST
GPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSD
DKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNL
FLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLA
IIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGD
GLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISL
AGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENF
EPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSD
DLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRL
SPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLT
LNKMPHDYGQEGPLEGKI

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Bours V., Villalobos J., Burd P.R., Kelly K., Siebenlist U. (1990). Cloning of a mitogen-inducible gene encoding a kappa B DNA-binding protein with homology to the rel oncogene and to cell-cycle motifs.. Nature 348: 76 — 80.  PubMed DOI:10.1038/348076a0
  • Heron E., Deloukas P., van Loon A.P.G.M. (1995). The complete exon-intron structure of the 156-kb human gene NFKB1, which encodes the p105 and p50 proteins of transcription factors NF-kappa B and I kappa B-gamma: implications for NF-kappa B-mediated signal transduction.. Genomics 30: 493 — 505.  PubMed DOI:10.1006/geno.1995.1270
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Palombella V.J., Rando O.J., Goldberg A.L., Maniatis T. (1994). The ubiquitin-proteasome pathway is required for processing the NF-kappa B1 precursor protein and the activation of NF-kappa B.. Cell 78: 773 — 785.  PubMed DOI:10.1016/S0092-8674(94)90482-0
  • Lin L., Ghosh S. (1996). A glycine-rich region in NF-kappaB p105 functions as a processing signal for the generation of the p50 subunit.. Mol. Cell. Biol. 16: 2248 — 2254.  PubMed DOI:10.1128/MCB.16.5.2248
  • Matthews J.R., Botting C.H., Panico M., Morris H.R., Hay R.T. (1996). Inhibition of NF-kappaB DNA binding by nitric oxide.. Nucleic Acids Res. 24: 2236 — 2242.  PubMed DOI:10.1093/nar/24.12.2236

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]