ETV1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ETV1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ETV1, ER81, ETS variant 1, ETS variant transcription factor 1
Зовнішні ІД OMIM: 600541 MGI: 99254 HomoloGene: 3636 GeneCards: ETV1
Шаблон експресії
PBB GE ETV1 217053 x at fs.png

PBB GE ETV1 217061 s at fs.png

PBB GE ETV1 206501 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001163154
NM_007960
NM_001347379
RefSeq (білок)
NP_001156626
NP_001334308
NP_031986
Локус (UCSC) Хр. 7: 13.89 – 13.99 Mb Хр. 12: 38.78 – 38.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ETV1 (англ. ETS variant 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 477 амінокислот, а молекулярна маса — 55 131[4].

Послідовність амінокислот
1020304050
MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDL
SQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEIS
SACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHH
ASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPL
PTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSF
PPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
FYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN
SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKG
IMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPL
SHFDESMAYMPEGGCCNPHPYNEGYVY

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wu J., Janknecht R. (2002). Regulation of the ETS transcription factor ER81 by the 90-kDa ribosomal S6 kinase 1 and protein kinase A.. J. Biol. Chem. 277: 42669 — 42679.  PubMed DOI:10.1074/jbc.M205501200
  • Janknecht R. (2003). Regulation of the ER81 transcription factor and its coactivators by mitogen- and stress-activated protein kinase 1 (MSK1).. Oncogene 22: 746 — 755.  PubMed DOI:10.1038/sj.onc.1206185
  • Gocke C.B., Yu H., Kang J. (2005). Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.. J. Biol. Chem. 280: 5004 — 5012.  PubMed DOI:10.1074/jbc.M411718200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3490 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P50549 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]