GTF3C2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF3C2
Ідентифікатори
Символи GTF3C2, TFIIIC-BETA, TFIIIC110, general transcription factor IIIC subunit 2
Зовнішні ІД OMIM: 604883 MGI: 1919002 HomoloGene: 37490 GeneCards: GTF3C2
Шаблон експресії
PBB GE GTF3C2 204366 s at fs.png

PBB GE GTF3C2 212429 s at fs.png

PBB GE GTF3C2 210620 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001035521
NM_001521
NM_001318909
NM_027901
RefSeq (білок)
NP_001030598
NP_001305838
NP_001512
NP_082177
Локус (UCSC) Хр. 2: 27.33 – 27.36 Mb Хр. 5: 31.16 – 31.18 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF3C2 (англ. General transcription factor IIIC subunit 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 911 амінокислот, а молекулярна маса — 100 680[4].

Послідовність амінокислот
1020304050
MDTCGVGYVALGEAGPVGNMTVVDSPGQEVLNQLDVKTSSEMTSAEASVE
MSLPTPLPGFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPG
RKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAE
LLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAAQVALLYLQELAE
ELSTALPAPVSCPEGPKVSSPTKPKKIRQPAACPGGEEVDGAPRDEDFFL
QVEAEDVEESEGPSESSSEPEPVVPRSTPRGSTSGKQKPHCRGMAPNGLP
NHIMAPVWKCLHLTKDFREQKHSYWEFAEWIPLAWKWHLLSELEAAPYLP
QEEKSPLFSVQREGLPEDGTLYRINRFSSITAHPERWDVSFFTGGPLWAL
DWCPVPEGAGASQYVALFSSPDMNETHPLSQLHSGPGLLQLWGLGTLQQE
SCPGNRAHFVYGIACDNGCIWDLKFCPSGAWELPGTPRKAPLLPRLGLLA
LACSDGKVLLFSLPHPEALLAQQPPDAVKPAIYKVQCVATLQVGSMQATD
PSECGQCLSLAWMPTRPHQHLAAGYYNGMVVFWNLPTNSPLQRIRLSDGS
LKLYPFQCFLAHDQAVRTLQWCKANSHFLVSAGSDRKIKFWDLRRPYEPI
NSIKRFLSTELAWLLPYNGVTVAQDNCYASYGLCGIHYIDAGYLGFKAYF
TAPRKGTVWSLSGSDWLGTIAAGDISGELIAAILPDMALNPINVKRPVER
RFPIYKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQD
TDLGSFHDLLRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYG
WLVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGF
SPTSHRLLPTP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • Sinn E., Wang Z., Kovelman R., Roeder R.G. (1995). Cloning and characterization of a TFIIIC2 subunit (TFIIIC beta) whose presence correlates with activation of RNA polymerase III-mediated transcription by adenovirus E1A expression and serum factors.. Genes Dev. 9: 675 — 685.  PubMed DOI:10.1101/gad.9.6.675
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4665 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q8WUA4 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]