ZPR1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZPR1
Ідентифікатори
Символи ZPR1, ZNF259, ZPR1 zinc finger
Зовнішні ІД OMIM: 603901 MGI: 1330262 HomoloGene: 2900 GeneCards: ZPR1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003904
NM_001317086
NM_011752
RefSeq (білок)
NP_001304015
NP_003895
NP_035882
Локус (UCSC) Хр. 11: 116.77 – 116.79 Mb Хр. 9: 46.27 – 46.28 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZPR1 (англ. ZPR1 zinc finger) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 459 амінокислот, а молекулярна маса — 50 925[4].

Послідовність амінокислот
1020304050
MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESL
CMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQG
VRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLI
TRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPS
GNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRN
EVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKS
GGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGK
FTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMK
AHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEG
YEAGLAPQR

Задіяний у таких біологічних процесах, як процесинг мРНК, сплайсинг мРНК, диференціація клітин. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі, клітинних відростках.

Література[ред. | ред. код]

  • Gangwani L., Mikrut M., Galcheva-Gargova Z., Davis R.J. (1998). Interaction of ZPR1 with translation elongation factor-1alpha in proliferating cells.. J. Cell Biol. 143: 1471 — 1484.  PubMed DOI:10.1083/jcb.143.6.1471
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gangwani L., Mikrut M., Theroux S., Sharma M., Davis R.J. (2001). Spinal muscular atrophy disrupts the interaction of ZPR1 with the SMN protein.. Nat. Cell Biol. 3: 376 — 383.  PubMed DOI:10.1038/35070059
  • Narayanan U., Ospina J.K., Frey M.R., Hebert M.D., Matera A.G. (2002). SMN, the spinal muscular atrophy protein, forms a pre-import snRNP complex with snurportin1 and importin beta.. Hum. Mol. Genet. 11: 1785 — 1795.  PubMed DOI:10.1093/hmg/11.15.1785
  • Gangwani L. (2006). Deficiency of the zinc finger protein ZPR1 causes defects in transcription and cell cycle progression.. J. Biol. Chem. 281: 40330 — 40340.  PubMed DOI:10.1074/jbc.M608165200
  • Ahmad S., Wang Y., Shaik G.M., Burghes A.H., Gangwani L. (2012). The zinc finger protein ZPR1 is a potential modifier of spinal muscular atrophy.. Hum. Mol. Genet. 21: 2745 — 2758.  PubMed DOI:10.1093/hmg/dds102

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13051 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, O75312 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]