HOXA13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXA13
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HOXA13, HOX1, HOX1J, homeobox A13
Зовнішні ІД OMIM: 142959 MGI: 96173 HomoloGene: 73882 GeneCards: HOXA13
Пов'язані генетичні захворювання
hand-foot-genital syndrome, Guttmacher syndrome[1]
Шаблон експресії
PBB GE HOXA13 gnf1h00031 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000522
NM_008264
RefSeq (білок)
NP_000513
NP_032290
Локус (UCSC) Хр. 7: 27.19 – 27.2 Mb Хр. 6: 52.26 – 52.26 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXA13 (англ. Homeobox A13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 388 амінокислот, а молекулярна маса — 39 727[5].

Послідовність амінокислот
1020304050
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAA
AGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPG
AASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAA
KQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASA
AAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYL
DMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH
LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD
KRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Mortlock D.P., Innis J.W. (1997). Mutation of HOXA13 in hand-foot-genital syndrome.. Nat. Genet. 15: 179 — 180.  PubMed DOI:10.1038/ng0297-179
  • Zhang Y., Larsen C.A., Stadler H.S., Ames J.B. (2011). Structural basis for sequence specific DNA binding and protein dimerization of HOXA13.. PLoS ONE 6: E23069 — E23069.  PubMed DOI:10.1371/journal.pone.0023069

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]