ZBTB17

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB17
Protein ZBTB17 PDB 2Q81.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZBTB17, MIZ-1, ZNF151, ZNF60, pHZ-67, zinc finger and BTB domain containing 17
Зовнішні ІД OMIM: 604084 MGI: 107410 HomoloGene: 2575 GeneCards: ZBTB17
Пов'язані генетичні захворювання
Дилатаційна кардіоміопатія[1]
Шаблон експресії
PBB GE ZBTB17 203602 s at fs.png

PBB GE ZBTB17 203601 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_009541
RefSeq (білок)
NP_033567
Локус (UCSC) Хр. 1: 15.94 – 15.98 Mb Хр. 4: 141.44 – 141.47 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB17 (англ. Zinc finger and BTB domain containing 17) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 803 амінокислот, а молекулярна маса — 87 928[5].

Послідовність амінокислот
1020304050
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFK
MLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQ
MQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRL
EQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADAPREPPPVELKPD
PTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEV
KEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACK
AHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFT
TSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPH
CDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEK
PYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVR
QHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEE
GSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEIS
KAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD
ADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPP
PAE

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lichter P., Bray P., Ried T., Dawid I.B., Ward D.C. (1992). Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.. Genomics 13: 999 — 1007.  PubMed DOI:10.1016/0888-7543(92)90013-I
  • Tommerup N., Vissing H. (1995). Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.. Genomics 27: 259 — 264.  PubMed DOI:10.1006/geno.1995.1040
  • Piluso D., Bilan P., Capone J.P. (2002). Host cell factor-1 interacts with and antagonizes transactivation by the cell cycle regulatory factor Miz-1.. J. Biol. Chem. 277: 46799 — 46808.  PubMed DOI:10.1074/jbc.M206226200
  • Zhao N., Wang J., Cui Y., Guo L., Lu S.-H. (2004). Induction of G1 cell cycle arrest and P15INK4b expression by ECRG1 through interaction with Miz-1.. J. Cell. Biochem. 92: 65 — 76.  PubMed DOI:10.1002/jcb.20025
  • Phan R.T., Saito M., Basso K., Niu H., Dalla-Favera R. (2005). BCL6 interacts with the transcription factor Miz-1 to suppress the cyclin-dependent kinase inhibitor p21 and cell cycle arrest in germinal center B cells.. Nat. Immunol. 6: 1054 — 1060.  PubMed DOI:10.1038/ni1245

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]