NR1I3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR1I3
Protein NR1I3 PDB 1xv9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1I3, CAR, CAR1, MB67, nuclear receptor subfamily 1 group I member 3
Зовнішні ІД OMIM: 603881 MGI: 1346307 HomoloGene: 3759 GeneCards: NR1I3
Реагує на сполуку
5β-pregnane-3,20-dione, Клотримазол, (RS)-meclizine[1]
Шаблон експресії
PBB GE NR1I3 207007 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243062
NM_001243063
NM_009803
RefSeq (білок)
NP_001229991
NP_001229992
NP_033933
Локус (UCSC) Хр. 1: 161.23 – 161.24 Mb Хр. 1: 171.21 – 171.22 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1I3 (англ. Nuclear receptor subfamily 1 group I member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 352 амінокислот, а молекулярна маса — 39 942[5].

Послідовність амінокислот
1020304050
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA
GSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQ
QTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPT
LAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVE
ICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFH
GTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI
KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEI
CS

Кодований геном білок за функціями належить до рецепторів, активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Choi H.S., Seol W., Moore D.D. (1996). A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily.. J. Steroid Biochem. Mol. Biol. 56: 23 — 30.  PubMed DOI:10.1016/0960-0760(95)00220-0
  • Kobayashi K., Sueyoshi T., Inoue K., Moore R., Negishi M. (2003). Cytoplasmic accumulation of the nuclear receptor CAR by a tetratricopeptide repeat protein in HepG2 cells.. Mol. Pharmacol. 64: 1069 — 1075.  PubMed DOI:10.1124/mol.64.5.1069

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]