ZNF471

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF471
Ідентифікатори
Символи ZNF471, ERP1, Z1971, zinc finger protein 471, Zfp78
Зовнішні ІД MGI: 107783 HomoloGene: 128524 GeneCards: ZNF471
Шаблон експресії
PBB GE ZNF471 211923 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020813
NM_001321768
NM_001025163
NM_001112805
NM_177888
RefSeq (білок)
NP_001308697
NP_065864
н/д
Локус (UCSC) Хр. 19: 56.51 – 56.53 Mb Хр. 7: 6.36 – 6.38 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF471 (англ. Zinc finger protein 471) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 626 амінокислот, а молекулярна маса — 73 009[4].

Послідовність амінокислот
1020304050
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSL
VSLGLCISKPYVISLLEQGREPWEMTSEMTRSPFSDWESIYVTQELPLKQ
FMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEMFSKKEIITHK
ETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVY
VGKKLFKCNECDKTFTHSSSLTVHFRIHTGEKPYACEECGKAFKQRQHLA
QHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYKCKECRKAFR
QPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIE
CGKAFRYNTSFIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGE
KPYKCGVCGKTFSSGSSRTVHQRIHTGEKPYECDICGKDFSHHASLTQHQ
RVHSGEKPYECKECGKAFRQNVHLVSHLRIHTGEKPYECKECGKAFRISS
QLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGEKPYECNECGK
AFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQ
CFECGKAFRRKLSLICHQRSHTGEEP

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 65 — 73.  PubMed DOI:10.1093/dnares/7.1.65

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:23226 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9BX82 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]