JUND

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
JUND
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи JUND, AP-1, JunD, JunD proto-oncogene, AP-1 transcription factor subunit
Зовнішні ІД OMIM: 165162 MGI: 96648 HomoloGene: 3910 GeneCards: JUND
Шаблон експресії
PBB GE JUND 214326 x at fs.png

PBB GE JUND 203751 x at fs.png

PBB GE JUND 203752 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005354
NM_001286968
NM_001286944
NM_010592
RefSeq (білок)
NP_001273897
NP_005345
NP_001273873
NP_034722
Локус (UCSC) Хр. 19: 18.28 – 18.28 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JUND (англ. JunD proto-oncogene, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 347 амінокислот, а молекулярна маса — 35 174[4].

Послідовність амінокислот
1020304050
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDAL
TLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLAS
PELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQ
NQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSY
AGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVP
SFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Berger I., Shaul Y. (1991). Structure and function of human jun-D.. Oncogene 6: 561 — 566.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6206 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P17535 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]