SPIB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPIB
Ідентифікатори
Символи SPIB, SPI-B, Spi-B transcription factor
Зовнішні ІД OMIM: 606802 MGI: 892986 HomoloGene: 79220 GeneCards: SPIB
Пов'язані генетичні захворювання
primary biliary cirrhosis[1]
Шаблон експресії
PBB GE SPIB 205861 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003121
NM_001243998
NM_001243999
NM_001244000
NM_019866
RefSeq (білок)
NP_001230927
NP_001230928
NP_001230929
NP_003112
NP_063919
Локус (UCSC) Хр. 19: 50.42 – 50.43 Mb Хр. 7: 44.53 – 44.53 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPIB (англ. Spi-B transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 262 амінокислот, а молекулярна маса — 28 819[5].

Послідовність амінокислот
1020304050
MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVA
PPVPATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGP
GLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPALEVSDSESDE
ALVAGPEGKGSEAGTRKKLRLYQFLLGLLTRGDMRECVWWVEPGAGVFQF
SSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQ
FDSALLPAVRRA

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Ray-Gallet D., Tavitian A., Moreau-Gachelin F. (1996). An alternatively spliced isoform of the Spi-B transcription factor.. Biochem. Biophys. Res. Commun. 223: 257 — 263.  PubMed DOI:10.1006/bbrc.1996.0881
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rao S., Matsumura A., Yoon J., Simon M.C. (1999). SPI-B activates transcription via a unique proline, serine, and threonine domain and exhibits DNA binding affinity differences from PU.1.. J. Biol. Chem. 274: 11115 — 11124.  PubMed DOI:10.1074/jbc.274.16.11115
  • Nagy M., Chapuis B., Matthes T. (2002). Expression of transcription factors Pu.1, Spi-B, Blimp-1, BSAP and oct-2 in normal human plasma cells and in multiple myeloma cells.. Br. J. Haematol. 116: 429 — 435.  PubMed DOI:10.1046/j.1365-2141.2002.03271.x
  • Schotte R., Nagasawa M., Weijer K., Spits H., Blom B. (2004). The ETS transcription factor Spi-B is required for human plasmacytoid dendritic cell development.. J. Exp. Med. 200: 1503 — 1509.  PubMed DOI:10.1084/jem.20041231

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]