FOXN3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXN3
Ідентифікатори
Символи FOXN3, C14orf116, CHES1, PRO1635, forkhead box N3
Зовнішні ІД OMIM: 602628 HomoloGene: 3809 GeneCards: FOXN3
Шаблон експресії
PBB GE CHES1 205022 s at fs.png

PBB GE CHES1 205021 s at fs.png

PBB GE CHES1 218031 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005197
NM_001085471
NM_001045263
RefSeq (білок)
NP_001078940
NP_005188
н/д
Локус (UCSC) Хр. 14: 89.12 – 89.62 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXN3 (англ. Forkhead box N3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 490 амінокислот, а молекулярна маса — 53 835[4].

Послідовність амінокислот
1020304050
MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRL
EEGAMEDEELTNLNWLHESKNLLKSFGESVLRSVSPVQDLDDDTPPSPAH
SDMPYDARQNPNCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPY
FANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLI
QALKKTPYHPHPHVFNTPPTCPQAYQSTSGPPIWPGSTFFKRNGALLQDP
DIDAASAMMLLNTPPEIQAGFPPGVIQNGARVLSRGLFPGVRPLPITPIG
VTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSP
TSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKH
SQKEPKDSLGDSGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDD
EEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Pati D., Keller C., Groudine M., Plon S.E. (1997). Reconstitution of a MEC1-independent checkpoint in yeast by expression of a novel human fork head cDNA.. Mol. Cell. Biol. 17: 3037 — 3046.  PubMed DOI:10.1128/MCB.17.6.3037
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Scott K.L., Plon S.E. (2005). CHES1/FOXN3 interacts with Ski-interacting protein and acts as a transcriptional repressor.. Gene 359: 119 — 126.  PubMed DOI:10.1016/j.gene.2005.06.014

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1928 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O00409 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]