PAX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PAX1
Ідентифікатори
Символи PAX1, HUP48, OFC2, paired box 1
Зовнішні ІД OMIM: 167411 MGI: 97485 HomoloGene: 4514 GeneCards: PAX1
Шаблон експресії
PBB GE PAX1 214401 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006192
NM_001257096
NM_008780
RefSeq (білок)
NP_001244025
NP_006183
NP_032806
Локус (UCSC) Хр. 20: 21.71 – 21.72 Mb Хр. 2: 147.36 – 147.39 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PAX1 (англ. Paired box 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 534 амінокислот, а молекулярна маса — 55 499[4].

Послідовність амінокислот
1020304050
MKFTLGLGSRAWRVSWEGAAAAAAGPGAGGSALRCRAQRVSSPRLGRRGS
RLSGALPLCLSRGGGGAQALPDCAGPSPGHPGHPGARQLAGPLAMEQTYG
EVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKI
LARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRL
LADGVCDKYNVPSVSSISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNH
IYQYPYPSPVSPTGAKMGSHPGVPGTAGHVSIPRSWPSAHSVSNILGIRT
FMEQTGALAGSEGTAYSPKMEDWAGVNRTAFPATPAVNGLEKPALEADIK
YTQSASTLSAVGGFLPACAYPASNQHGVYSAPGGGYLAPGPPWPPAQGPP
LAPPGAGVAVHGGELAAAMTFKHPSREGSLPAPAARPRTPSVAYTDCPSR
PRPPRGSSPRTRARRERQADPGAQVCAAAPAIGTGRIGGLAEEEASAGPR
GARPASPQAQPCLWPDPPHFLYWSGFLGFSELGF

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Burri M., Tromvoukis Y., Bopp D., Frigerio G., Noll M. (1989). Conservation of the paired domain in metazoans and its structure in three isolated human genes.. EMBO J. 8: 1183 — 1190.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8615 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P15863 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]