ELK4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ELK4
Protein ELK4 PDB 1bc7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ELK4, SAP1, ETS transcription factor, ETS transcription factor ELK4
Зовнішні ІД OMIM: 600246 MGI: 102853 HomoloGene: 1492 GeneCards: ELK4
Шаблон експресії
PBB GE ELK4 206919 at fs.png

PBB GE ELK4 205994 at fs.png

PBB GE ELK4 214831 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001973
NM_021795
RefSeq (білок)
NP_001964
NP_068567
NP_068567.1
NP_001964.2
NP_031949
Локус (UCSC) Хр. 1: 205.6 – 205.63 Mb Хр. 1: 132.01 – 132.03 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ELK4 (англ. ELK4, ETS transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 431 амінокислот, а молекулярна маса — 46 900[4].

Послідовність амінокислот
1020304050
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKN
KPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGR
IEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSF
TLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPP
VEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFA
TTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT
ASLTPAFFSQTPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQF
PSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Dalton S., Treisman R. (1992). Characterization of SAP-1, a protein recruited by serum response factor to the c-fos serum response element.. Cell 68: 597 — 612.  PubMed DOI:10.1016/0092-8674(92)90194-H
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mo Y., Vaessen B., Johnston K., Marmorstein R. (1998). Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.. Mol. Cell 2: 201 — 212.  PubMed DOI:10.1016/S1097-2765(00)80130-6
  • Dalton S., Treisman R. (1994). Characterization of SAP-1, a protein recruited by serum response factor to the c-fos serum response element.. Cell 76: 411 — 411.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3326 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P28324 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]