GATA1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GATA1
Protein GATA1 PDB 1gnf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GATA1, ERYF1, GATA-1, GF-1, GF1, NF-E1, NFE1, XLANP, XLTDA, XLTT, GATA binding protein 1
Зовнішні ІД OMIM: 305371 MGI: 95661 HomoloGene: 1549 GeneCards: GATA1
Шаблон експресії
PBB GE GATA1 210446 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002049
NM_008089
RefSeq (білок)
NP_002040
NP_032115
Локус (UCSC) Хр. X: 48.79 – 48.79 Mb Хр. X: 7.96 – 7.98 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GATA1 (англ. GATA binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 413 амінокислот, а молекулярна маса — 42 751[4].

Послідовність амінокислот
1020304050
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAP
STATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGK
TGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGP
ALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCE
ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIV
SKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVA
SGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMP
PTTSTTVVAPLSS

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Trainor C.D., Evans T., Felsenfeld G., Boguski M.S. (1990). Structure and evolution of a human erythroid transcription factor.. Nature 343: 92 — 96.  PubMed DOI:10.1038/343092a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Calligaris R., Bottardi S., Cogoi S., Apezteguia I., Santoro C. (1995). Alternative translation initiation site usage results in two functionally distinct forms of the GATA-1 transcription factor.. Proc. Natl. Acad. Sci. U.S.A. 92: 11598 — 11602.  PubMed DOI:10.1073/pnas.92.25.11598
  • Boyes J., Byfield P., Nakatani Y., Ogryzko V. (1998). Regulation of activity of the transcription factor GATA-1 by acetylation.. Nature 396: 594 — 598.  PubMed DOI:10.1038/25166
  • Kuo Y.-Y., Chang Z.-F. (2007). GATA-1 and Gfi-1B interplay to regulate Bcl-xL transcription.. Mol. Cell. Biol. 27: 4261 — 4272.  PubMed DOI:10.1128/MCB.02212-06
  • Mehaffey M.G., Newton A.L., Gandhi M.J., Crossley M., Drachman J.G. (2001). X-linked thrombocytopenia caused by a novel mutation of GATA-1.. Blood 98: 2681 — 2688.  PubMed DOI:10.1182/blood.V98.9.2681

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4170 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P15976 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]