KDM5B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KDM5B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KDM5B, CT31, JARID1B, PLU-1, PLU1, PPP1R98, PUT1, RBBP2H1A, RBP2-H1, lysine demethylase 5B, MRT65
Зовнішні ІД OMIM: 605393 MGI: 1922855 HomoloGene: 48448 GeneCards: KDM5B
Шаблон експресії
PBB GE JARID1B 201549 x at fs.png

PBB GE JARID1B 201547 at fs.png

PBB GE JARID1B 201548 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001314042
NM_006618
NM_001347591
NM_152895
RefSeq (білок)
NP_001300971
NP_001334520
NP_006609
NP_690855
Локус (UCSC) Хр. 1: 202.72 – 202.81 Mb Хр. 1: 134.56 – 134.64 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KDM5B (англ. Lysine demethylase 5B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 544 амінокислот, а молекулярна маса — 175 658[4].

Послідовність амінокислот
1020304050
MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIH
KIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVK
LNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDR
KWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLT
TDTKDKEYKPHDIPQRQSVQPSETCPPARRAKRMRAEAMNIKIEPEETTE
ARTHNLRRRMGCPTPKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRS
KKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGD
WRCPKCLAQECSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHM
VPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPE
EEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHI
EDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLH
QLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV
NFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVAST
VQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCF
MSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKL
RAESYNEWALNVNEALEAKINKKKSLVSFKALIEESEMKKFPDNDLLRHL
RLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLY
ALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEF
DVELPQLAEMRIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAP
YSAVEKAMARLQELLTVSEHWDDKAKSLLKARPRHSLNSLATAVKEIEEI
PAYLPNGAALKDSVQRARDWLQDVEGLQAGGRVPVLDTLIELVTRGRSIP
VHLNSLPRLETLVAEVQAWKECAVNTFLTENSPYSLLEVLCPRCDIGLLG
LKRKQRKLKEPLPNGKKKSTKLESLSDLERALTESKETASAMATLGEARL
REMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMIQCELCRDAFH
TSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGD
ALRYMIERTVNWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSD
TNKVSQPPGTTSFSLPDDWDNRTSYLHSPFSTGRSCIPLHGVSPEVNELL
MEAQLLQVSLPEIQELYQTLLAKPSPAQQTDRSSPVRPSSEKNDCCRGKR
DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFK
LERERSYELVRSAETHSLPSDTSYSEQEDSEDEDAICPAVSCLQPEGDEV
DWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK

Кодований геном білок за функціями належить до оксидоредуктаз, репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, біологічні ритми, ацетиляція. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у ядрі.

Література[ред. | ред. код]

  • Secombe J., Li L., Carlos L., Eisenman R.N. (2007). The Trithorax group protein Lid is a trimethyl histone H3K4 demethylase required for dMyc-induced cell growth.. Genes Dev. 21: 537 — 551.  PubMed DOI:10.1101/gad.1523007

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18039 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9UGL1 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]