ZNF346

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF346
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZNF346, JAZ, Zfp346, zinc finger protein 346
Зовнішні ІД OMIM: 605308 MGI: 1349417 HomoloGene: 8073 GeneCards: ZNF346
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012017
RefSeq (білок)
NP_036147
Локус (UCSC) Хр. 5: 177.02 – 177.08 Mb Хр. 13: 55.11 – 55.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF346 (англ. Zinc finger protein 346) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 294 амінокислот, а молекулярна маса — 32 933[4].

Послідовність амінокислот
1020304050
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSG
AQPVGREEVEHMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANK
VKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQ
SHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMA
QQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNS
IEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED

Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, РНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Yang M., May W.S., Ito T. (1999). JAZ requires the double-stranded RNA-binding zinc finger motifs for nuclear localization.. J. Biol. Chem. 274: 27399 — 27406.  PubMed DOI:10.1074/jbc.274.39.27399
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chen T., Brownawell A.M., Macara I.G. (2004). Nucleocytoplasmic shuttling of JAZ, a new cargo protein for exportin-5.. Mol. Cell. Biol. 24: 6608 — 6619.  PubMed DOI:10.1128/MCB.24.15.6608-6619.2004
  • Burge R.G., Martinez-Yamout M.A., Dyson H.J., Wright P.E. (2014). Structural characterization of interactions between the double-stranded RNA-binding zinc finger protein JAZ and nucleic acids.. Biochemistry 53: 1495 — 1510.  PubMed DOI:10.1021/bi401675h

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16403 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q9UL40 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]