DBP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DBP
Ідентифікатори
Символи DBP, DABP, D-box binding PAR bZIP transcription factor, taxREB302
Зовнішні ІД OMIM: 124097 MGI: 94866 HomoloGene: 1035 GeneCards: DBP
Шаблон експресії
PBB GE DBP 209783 at fs.png

PBB GE DBP 209782 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001352
NM_016974
RefSeq (білок)
NP_001343
NP_058670
Локус (UCSC) Хр. 19: 48.63 – 48.64 Mb Хр. 7: 45.71 – 45.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DBP (англ. D-box binding PAR bZIP transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 325 амінокислот, а молекулярна маса — 34 349[4].

Послідовність амінокислот
1020304050
MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLK
EKERKAALPAATTPGPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLL
APLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSPEPSPARTPAP
SPGPGSCGSASPRSSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVE
VLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVP
EEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE
VVAVRQELSHYRAVLSRYQAQHGAL

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Khatib Z.A., Inaba T., Valentine M., Look A.T. (1994). Chromosomal localization and cDNA cloning of the human DBP and TEF genes.. Genomics 23: 344 — 351.  PubMed DOI:10.1006/geno.1994.1510
  • Shutler G., Glassco T., Kang X., Korneluk R., Mueller C.R. (1996). Genomic structure of the human D-site binding protein (DBP) gene.. Genomics 34: 334 — 339.  PubMed DOI:10.1006/geno.1996.0295
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Brown S.A., Schibler U. (1999). The ins and outs of circadian timekeeping.. Curr. Opin. Genet. Dev. 9: 588 — 594.  PubMed DOI:10.1016/S0959-437X(99)00009-X

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2697 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q10586 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]