EPAS1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
EPAS1
Protein EPAS1 PDB 1p97.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EPAS1, ECYT4, HIF2A, HLF, MOP2, PASD2, bHLHe73, endothelial PAS domain protein 1, Hypoxia-inducible factor-2alpha
Зовнішні ІД OMIM: 603349 MGI: 109169 HomoloGene: 1095 GeneCards: EPAS1
Пов'язані генетичні захворювання
Рак нирки[1]
Шаблон експресії
PBB GE EPAS1 200879 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001430
NM_010137
RefSeq (білок)
NP_001421
NP_034267
Локус (UCSC) Хр. 2: 46.29 – 46.39 Mb Хр. 17: 86.75 – 86.83 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EPAS1 (англ. Endothelial PAS domain protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 870 амінокислот, а молекулярна маса — 96 459[5].

Послідовність амінокислот
1020304050
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSH
LDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIA
VVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLK
NGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVK
VYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSM
DMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN
DVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEEL
AQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSE
AGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEV
IEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEER
LLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPE
HRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPT
KWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMV
ALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPL
MPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFP
PQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPV
LGSSTLLQGGDLLRALDQAT

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ангіогенез, диференціація, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Tian H., McKnight S.L., Russell D.W. (1997). Endothelial PAS domain protein 1 (EPAS1), a transcription factor selectively expressed in endothelial cells.. Genes Dev. 11: 72 — 82.  PubMed DOI:10.1101/gad.11.1.72
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]