TAF13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF13
Protein TAF13 PDB 1bh8.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF13, TAF(II)18, TAF2K, TAFII-18, TAFII18, TATA-box binding protein associated factor 13, MRT60
Зовнішні ІД OMIM: 600774 MGI: 1913500 HomoloGene: 4126 GeneCards: TAF13
Шаблон експресії
PBB GE TAF13 205966 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005645
NM_025444
RefSeq (білок)
NP_005636
NP_079720
Локус (UCSC) Хр. 1: 109.06 – 109.08 Mb Хр. 3: 108.57 – 108.58 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF13 (англ. TATA-box binding protein associated factor 13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 124 амінокислот, а молекулярна маса — 14 287[4].

Послідовність амінокислот
1020304050
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPY
TESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARV
KDLLTMNEELKRARKAFDEANYGS

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11546 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q15543 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]