HLX

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HLX
Ідентифікатори
Символи HLX, HB24, HLX1, H2.0 like homeobox
Зовнішні ІД OMIM: 142995 MGI: 96109 HomoloGene: 7363 GeneCards: HLX
Шаблон експресії
PBB GE HLX1 214438 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021958
NM_008250
RefSeq (білок)
NP_068777
NP_032276
Локус (UCSC) Хр. 1: 220.88 – 220.89 Mb Хр. 1: 184.73 – 184.73 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HLX (англ. H2.0 like homeobox) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 488 амінокислот, а молекулярна маса — 50 789[4].

Послідовність амінокислот
1020304050
MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADIL
HAGVGDLGAAPEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVA
PSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPPPPRAGALQPP
ASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLT
SLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQH
QFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKY
VTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEK
PSGGAPAADGEQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERS
LHQTTVIKAPVTGALITASSAGSGGSSGGGGNSFSFSSASSLSSSSTSAG
CASSLGGGGASELLPATQPTASSAPKSPEPAQGALGCL

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kennedy M.A., Rayner J.C., Morris C.M. (1994). Genomic structure, promoter sequence, and revised translation of human homeobox gene HLX1.. Genomics 22: 348 — 355.  PubMed DOI:10.1006/geno.1994.1394
  • Nishimura D.Y., Purchio A.F., Murray J.C. (1993). Linkage localization of TGFB2 and the human homeobox gene HLX1 to chromosome 1q.. Genomics 15: 357 — 364.  PubMed DOI:10.1006/geno.1993.1068

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4978 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q14774 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]