GTF2H1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2H1
Protein GTF2H1 PDB 1pfj.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2H1, BTF2, P62, TFB1, TFIIH, general transcription factor IIH subunit 1
Зовнішні ІД OMIM: 189972 MGI: 1277216 HomoloGene: 3885 GeneCards: GTF2H1
Пов'язані генетичні захворювання
рак підшлункової залози[1]
Шаблон експресії
PBB GE GTF2H1 202453 s at fs.png

PBB GE GTF2H1 202451 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001142307
NM_005316
NM_001291075
NM_008186
NM_001360075
NM_001360076
RefSeq (білок)
NP_001135779
NP_005307
NP_001278004
NP_032212
NP_001347004
NP_001347005
Локус (UCSC) Хр. 11: 18.32 – 18.37 Mb Хр. 7: 46.8 – 46.82 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2H1 (англ. General transcription factor IIH subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 548 амінокислот, а молекулярна маса — 62 032[5].

Послідовність амінокислот
1020304050
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADI
KCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLL
PKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVN
ATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTY
PAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKID
EKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVK
RAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDI
INSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQAIN
QMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERF
QVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, ацетилювання, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kershnar E., Wu S.-Y., Chiang C.-M. (1998). Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.. J. Biol. Chem. 273: 34444 — 34453.  PubMed DOI:10.1074/jbc.273.51.34444

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]