NRF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NRF1
Ідентифікатори
Символи NRF1, ALPHA-PAL, nuclear respiratory factor 1
Зовнішні ІД OMIM: 600879 MGI: 1332235 HomoloGene: 3674 GeneCards: NRF1
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE NRF1 204652 s at fs.png

PBB GE NRF1 204651 at fs.png

PBB GE NRF1 211279 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005011
NM_001040110
NM_001293163
NM_001293164
RefSeq (білок)
NP_001035199
NP_001280092
NP_001280093
NP_005002
Локус (UCSC) Хр. 7: 129.61 – 129.76 Mb Хр. 6: 30.05 – 30.15 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NRF1 (англ. Nuclear respiratory factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 503 амінокислот, а молекулярна маса — 53 541[5].

Послідовність амінокислот
1020304050
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED
TSYDDSDILNSTAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESN
PSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKPNPVFKVFGAA
PLENVVRKYKSMILEDLESALAEHAPAPQEVNSELPPLTIDGIPVSVDKM
TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTE
EQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSA
VADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGA
TVTMALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGALTGVQDANG
LVQIPVSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVTMDGQAVEVVT
LEQ

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Virbasius C.A., Virbasius J.V., Scarpulla R.C. (1993). NRF-1, an activator involved in nuclear-mitochondrial interactions, utilizes a new DNA-binding domain conserved in a family of developmental regulators.. Genes Dev. 7: 2431 — 2445.  PubMed DOI:10.1101/gad.7.12a.2431
  • Gopalakrishnan L., Scarpulla R.C. (1995). Structure, expression, and chromosomal assignment of the human gene encoding nuclear respiratory factor 1.. J. Biol. Chem. 270: 18019 — 18025.  PubMed DOI:10.1074/jbc.270.30.18019
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Spelbrink J.N., Van den Bogert C. (1995). The pre-mRNA of nuclear respiratory factor 1, a regulator of mitochondrial biogenesis, is alternatively spliced in human tissues and cell lines.. Hum. Mol. Genet. 4: 1591 — 1596.  PubMed DOI:10.1093/hmg/4.9.1591
  • Gugneja S., Scarpulla R.C. (1997). Serine phosphorylation within a concise amino-terminal domain in nuclear respiratory factor 1 enhances DNA binding.. J. Biol. Chem. 272: 18732 — 18739.  PubMed DOI:10.1074/jbc.272.30.18732
  • Andersson U., Scarpulla R.C. (2001). Pgc-1-related coactivator, a novel, serum-inducible coactivator of nuclear respiratory factor 1-dependent transcription in mammalian cells.. Mol. Cell. Biol. 21: 3738 — 3749.  PubMed DOI:10.1128/MCB.21.11.3738-3749.2001

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]