REL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
REL
Ідентифікатори
Символи REL, C-Rel, REL proto-oncogene, NF-kB subunit
Зовнішні ІД OMIM: 164910 MGI: 97897 HomoloGene: 2182 GeneCards: REL
Пов'язані генетичні захворювання
Ревматоїдний артрит, psoriatic arthritis[1]
Шаблон експресії
PBB GE REL 206036 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001291746
NM_002908
NM_009044
RefSeq (білок)
NP_001278675
NP_002899
NP_033070
Локус (UCSC) Хр. 2: 60.88 – 60.93 Mb Хр. 11: 23.74 – 23.77 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

REL (англ. REL proto-oncogene, NF-kB subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 619 амінокислот, а молекулярна маса — 68 520[5].

Послідовність амінокислот
1020304050
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSI
QIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPL
FFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRL
CFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRG
GDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYC
KAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGL
LGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSH
HASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIP
VGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMT
TSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANS
NTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Brownell E., O'Brien S.J., Nash W.G., Rice N.R. (1985). Genetic characterization of human c-rel sequences.. Mol. Cell. Biol. 5: 2826 — 2831.  PubMed DOI:10.1128/MCB.5.10.2826
  • Li Z., Nabel G.J. (1997). A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription.. Mol. Cell. Biol. 17: 6184 — 6190.  PubMed DOI:10.1128/MCB.17.10.6184
  • Martin A.G., Fresno M. (2000). Tumor necrosis factor-alpha activation of NF-kappa B requires the phosphorylation of Ser-471 in the transactivation domain of c-Rel.. J. Biol. Chem. 275: 24383 — 24391.  PubMed DOI:10.1074/jbc.M909396199
  • Guizani-Tabbane L., Ben-Aissa K., Belghith M., Sassi A., Dellagi K. (2004). Leishmania major amastigotes induce p50/c-Rel NF-kappa B transcription factor in human macrophages: involvement in cytokine synthesis.. Infect. Immun. 72: 2582 — 2589.  PubMed DOI:10.1128/IAI.72.5.2582-2589.2004
  • Brownell E., Mittereder N., Rice N.R. (1989). A human rel proto-oncogene cDNA containing an Alu fragment as a potential coding exon.. Oncogene 4: 935 — 942.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]