POU1F1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
POU1F1
Protein POU1F1 PDB 1au7.png
Ідентифікатори
Символи POU1F1, CPHD1, GHF-1, PIT1, POU1F1a, Pit-1, POU class 1 homeobox 1
Зовнішні ІД OMIM: 173110 MGI: 97588 HomoloGene: 259 GeneCards: POU1F1
Шаблон експресії
PBB GE POU1F1 207846 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001122757
NM_000306
NM_008849
NM_001362468
RefSeq (білок)
NP_000297
NP_001116229
NP_032875
NP_001349397
Локус (UCSC) Хр. 3: 87.26 – 87.28 Mb Хр. 16: 65.52 – 65.54 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

POU1F1 (англ. POU class 1 homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 291 амінокислот, а молекулярна маса — 32 912[4].

Послідовність амінокислот
1020304050
MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATG
LHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAE
DPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQ
TNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQV
GALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEE
LNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lew A.M., Elsholtz H.P. (1991). Cloning of the human cDNA for transcription factor Pit-1.. Nucleic Acids Res. 19: 6329 — 6329.  PubMed DOI:10.1093/nar/19.22.6329
  • Tatsumi K.I., Notomi T., Amino N., Miyai K. (1992). Nucleotide sequence of the complementary DNA for human Pit-1/GHF-1.. Biochim. Biophys. Acta 1129: 231 — 234.  PubMed DOI:10.1016/0167-4781(92)90494-K
  • Delhase M., Vila V., Hooghe-Peters E.L., Castrillo J.-L. (1995). A novel pituitary transcription factor is produced by alternative splicing of the human GHF-1/PIT-1 gene.. Gene 155: 273 — 275.  PubMed DOI:10.1016/0378-1119(94)00757-J
  • Pernasetti F.M., Wera S., Belayew A., Martial J.A. (1993). Cloning of a human GHF-1/Pit-1 cDNA variant.. Nucleic Acids Res. 21: 3584 — 3584.  PubMed DOI:10.1093/nar/21.15.3584
  • Turton J.P., Strom M., Langham S., Dattani M.T., Le Tissier P. (2012). Two novel mutations in the POU1F1 gene generate null alleles through different mechanisms leading to c ombined pituitary hormone deficiency.. Clin. Endocrinol. (Oxf.) 76: 387 — 393.  PubMed DOI:10.1111/j.1365-2265.2011.04236.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9210 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P28069 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]