GTF3C1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF3C1
Ідентифікатори
Символи GTF3C1, TFIIIC, TFIIIC220, TFIIICalpha, general transcription factor IIIC subunit 1
Зовнішні ІД OMIM: 603246 MGI: 107887 HomoloGene: 31040 GeneCards: GTF3C1
Шаблон експресії
PBB GE GTF3C1 202320 at fs.png

PBB GE GTF3C1 35671 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001286242
NM_001520
NM_207239
RefSeq (білок)
NP_001273171
NP_001511
NP_997122
Локус (UCSC) Хр. 16: 27.46 – 27.55 Mb Хр. 7: 125.64 – 125.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF3C1 (англ. General transcription factor IIIC subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 109 амінокислот, а молекулярна маса — 238 875[4].

Послідовність амінокислот
1020304050
MDALESLLDEVALEGLDGLCLPALWSRLETRVPPFPLPLEPCTQEFLWRA
LATHPGISFYEEPRERPDLQLQDRYEEIDLETGILESRRDPVALEDVYPI
HMILENKDGIQGSCRYFKERKNITNDIRTKSLQPRCTMVEAFDRWGKKLI
IVASQAMRYRALIGQEGDPDLKLPDFSYCILERLGRSRWQGELQRDLHTT
AFKVDAGKLHYHRKILNKNGLITMQSHVIRLPTGAQQHSILLLLNRFHVD
RRSKYDILMEKLSVMLSTRTNHIETLGKLREELGLCERTFKRLYQYMLNA
GLAKVVSLRLQEIHPECGPCKTKKGTDVMVRCLKLLKEFKRNDHDDDEDE
EVISKTVPPVDIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEA
RMLCRLLQRFKVVKGFMEDEGRQRTTKYISCVFAEESDLSRQYQREKARS
ELLTTVSLASMQEESLLPEGEDTFLSESDSEEERSSSKRRGRGSQKDTRA
SANLRPKTQPHHSTPTKGGWKVVNLHPLKKQPPSFPGAAEERACQSLASR
DSLLDTSSVSEPNVSFVSHCADSNSGDIAVIEEVRMENPKESSSSLKTGR
HSSGQDKPHETYRLLKRRNLIIEAVTNLRLIESLFTIQKMIMDQEKQEGV
STKCCKKSIVRLVRNLSEEGLLRLYRTTVIQDGIKKKVDLVVHPSMDQND
PLVRSAIEQVRFRISNSSTANRVKTSQPPVPQGEAEEDSQGKEGPSGSGD
SQLSASSRSESGRMKKSDNKMGITPLRNYHPIVVPGLGRSLGFLPKMPRL
RVVHMFLWYLIYGHPASNTVEKPSFISERRTIKQESGRAGVRPSSSGSAW
EACSEAPSKGSQDGVTWEAEVELATETVYVDDASWMRYIPPIPVHRDFGF
GWALVSDILLCLPLSIFIQIVQVSYKVDNLEEFLNDPLKKHTLIRFLPRP
IRQQLLYKRRYIFSVVENLQRLCYMGLLQFGPTEKFQDKDQVFIFLKKNA
VIVDTTICDPHYNLARSSRPFERRLYVLNSMQDVENYWFDLQCVCLNTPL
GVVRCPRVRKNSSTDQGSDEEGSLQKEQESAMDKHNLERKCAMLEYTTGS
REVVDEGLIPGDGLGAAGLDSSFYGHLKRNWIWTSYIINQAKKENTAAEN
GLTVRLQTFLSKRPMPLSARGNSRLNIWGEARVGSELCAGWEEQFEVDRE
PSLDRNRRVRGGKSQKRKRLKKDPGKKIKRKKKGEFPGEKSKRLRYHDEA
DQSALQRMTRLRVTWSMQEDGLLVLCRIASNVLNTKVKGPFVTWQVVRDI
LHATFEESLDKTSHSVGRRARYIVKNPQAYLNYKVCLAEVYQDKALVGDF
MNRRGDYDDPKVCANEFKEFVEKLKEKFSSALRNSNLEIPDTLQELFARY
RVLAIGDEKDQTRKEDELNSVDDIHFLVLQNLIQSTLALSDSQMKSYQSF
QTFRLYREYKDHVLVKAFMECQKRSLVNRRRVNHTLGPKKNRALPFVPMS
YQLSQTYYRIFTWRFPSTICTESFQFLDRMRAAGKLDQPDRFSFKDQDNN
EPTNDMVAFSLDGPGGNCVAVLTLFSLGLISVDVRIPEQIIVVDSSMVEN
EVIKSLGKDGSLEDDEDEEDDLDEGVGGKRRSMEVKPAQASHTNYLLMRG
YYSPGIVSTRNLNPNDSIVVNSCQMKFQLRCTPVPARLRPAAAPLEELTM
GTSCLPDTFTKLINPQENTCSLEEFVLQLELSGYSPEDLTAALEILEAII
ATGCFGIDKEELRRRFSALEKAGGGRTRTFADCIQALLEQHQVLEVGGNT
ARLVAMGSAWPWLLHSVRLKDREDADIQREDPQARPLEGSSSEDSPPEGQ
APPSHSPRGTKRRASWASENGETDAEGTQMTPAKRPALQDSNLAPSLGPG
AEDGAEAQAPSPPPALEDTAAAGAAQEDQEGVGEFSSPGQEQLSGQAQPP
EGSEDPRGFTESFGAANISQAARERDCESVCFIGRPWRVVDGHLNLPVCK
GMMEAMLYHIMTRPGIPESSLLRHYQGVLQPVAVLELLQGLESLGCIRKR
WLRKPRPVSLFSTPVVEEVEVPSSLDESPMAFYEPTLDCTLRLGRVFPHE
VNWNKWIHL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • L'Etoile N.D., Fahnestock M.L., Shen Y., Aebersold R., Berk A.J. (1994). Human transcription factor IIIC box B binding subunit.. Proc. Natl. Acad. Sci. U.S.A. 91: 1652 — 1656.  PubMed DOI:10.1073/pnas.91.5.1652
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lagna G., Kovelman R., Sukegawa J., Roeder R.G. (1994). Cloning and characterization of an evolutionarily divergent DNA-binding subunit of mammalian TFIIIC.. Mol. Cell. Biol. 14: 3053 — 3064.  PubMed DOI:10.1128/MCB.14.5.3053
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • de Planell-Saguer M., Schroeder D.G., Rodicio M.C., Cox G.A., Mourelatos Z. (2009). Biochemical and genetic evidence for a role of IGHMBP2 in the translational machinery.. Hum. Mol. Genet. 18: 2115 — 2126.  PubMed DOI:10.1093/hmg/ddp134

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4664 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q12789 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]