GATA2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GATA2
PDB 1gnf EBI.jpg
Ідентифікатори
Символи GATA2, DCML, IMD21, MONOMAC, NFE1B, GATA binding protein 2
Зовнішні ІД OMIM: 137295 MGI: 95662 HomoloGene: 32030 GeneCards: GATA2
Пов'язані генетичні захворювання
MonoMAC, Emberger syndrome, мієлодиспластичний синдром[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032638
NM_001145661
NM_001145662
NM_008090
NM_001355253
RefSeq (білок)
NP_001139133
NP_001139134
NP_116027
NP_032116
NP_001342182
Локус (UCSC) Хр. 3: 128.48 – 128.49 Mb Хр. 6: 88.19 – 88.21 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GATA2 (англ. GATA binding protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 480 амінокислот, а молекулярна маса — 50 500[5].

Послідовність амінокислот
1020304050
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFN
HLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDG
GKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGG
GSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGG
SAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYP
SYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKM
SNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSG
HILPTPTPIHPSSSLSFGHPHPSSMVTAMG

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lee M.-E., Temizer D.T., Clifford J.A., Quertermous T. (1991). Cloning of the GATA-binding protein that regulates endothelin-1 gene expression in endothelial cells.. J. Biol. Chem. 266: 16188 — 16192.  PubMed
  • Dorfman D.M., Wilson D.B., Bruns G.A.P., Orkin S.H. (1992). Human transcription factor GATA-2. Evidence for regulation of preproendothelin-1 gene expression in endothelial cells.. J. Biol. Chem. 267: 1279 — 1285.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]