NR2E1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR2E1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR2E1, TLL, TLX, XTLL, nuclear receptor subfamily 2 group E member 1
Зовнішні ІД OMIM: 603849 MGI: 1100526 HomoloGene: 37750 GeneCards: NR2E1
Шаблон експресії
PBB GE NR2E1 207443 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001286102
NM_003269
NM_152229
RefSeq (білок)
NP_001273031
NP_003260
NP_689415
Локус (UCSC) Хр. 6: 108.17 – 108.19 Mb Хр. 10: 42.56 – 42.58 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR2E1 (англ. Nuclear receptor subfamily 2 group E member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 385 амінокислот, а молекулярна маса — 42 589[4].

Послідовність амінокислот
1020304050
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
VCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIR
KQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTT
PERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWA
KSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNG
DNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPAL
RSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Jackson A., Panayiotidis P., Foroni L. (1998). The human homologue of the Drosophila tailless gene (TLX): characterization and mapping to a region of common deletion in human lymphoid leukemia on chromosome 6q21.. Genomics 50: 34 — 43.  PubMed DOI:10.1006/geno.1998.5270
  • Kobayashi M., Yu R.T., Yasuda K., Umesono K. (2000). Cell-type-specific regulation of the retinoic acid receptor mediated by the orphan nuclear receptor TLX.. Mol. Cell. Biol. 20: 8731 — 8739.  PubMed DOI:10.1128/MCB.20.23.8731-8739.2000
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7973 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q9Y466 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]