CREM

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CREM
Protein CREM PDB 1dh3.png
Ідентифікатори
Символи CREM, CREM-2, ICER, hCREM-2, cAMP responsive element modulator
Зовнішні ІД OMIM: 123812 MGI: 88495 HomoloGene: 84591 GeneCards: CREM
Шаблон експресії
PBB GE CREM 210171 s at fs.png

PBB GE CREM 207630 s at fs.png

PBB GE CREM 209967 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 10: 35.13 – 35.21 Mb Хр. 18: 3.27 – 3.34 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CREM (англ. CAMP responsive element modulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 361 амінокислот, а молекулярна маса — 38 940[4].

Послідовність амінокислот
1020304050
MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNS
IPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSE
IHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPG
VPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPG
SDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDE
ETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELET
LKDICSPKTDY

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, диференціація клітин, сперматогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Fujimoto T., Fujisawa J., Yoshida M. (1994). Novel isoforms of human cyclic AMP-responsive element modulator (hCREM) mRNA.. J. Biochem. 115: 298 — 303.  PubMed DOI:10.1093/oxfordjournals.jbchem.a124332
  • Bodor J., Spetz A.L., Strominger J.L., Habener J.F. (1996). cAMP inducibility of transcriptional repressor ICER in developing and mature human T lymphocytes.. Proc. Natl. Acad. Sci. U.S.A. 93: 3536 — 3541.  PubMed DOI:10.1073/pnas.93.8.3536
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gellersen B., Kempf R., Sandhowe R., Weinbauer G.F., Behr R. (2002). Novel leader exons of the cyclic adenosine 3',5'-monophosphate response element modulator (CREM) gene, transcribed from promoters P3 and P4, are highly testis-specific in primates.. Mol. Hum. Reprod. 8: 965 — 976.  PubMed DOI:10.1093/molehr/8.11.965
  • Meyer T.E., Habener J.F. (1992). Cyclic AMP response element binding protein CREB and modulator protein CREM are products of distinct genes.. Nucleic Acids Res. 20: 6106 — 6106.  PubMed DOI:10.1093/nar/20.22.6106
  • Pati D., Meistrich M.L., Plon S.E. (1999). Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis.. Mol. Cell. Biol. 19: 5001 — 5013.  PubMed DOI:10.1128/MCB.19.7.5001

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2352 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q03060 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]