ARNT

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARNT
Protein ARNT PDB 1x0o.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARNT, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2, aryl hydrocarbon receptor nuclear translocator
Зовнішні ІД OMIM: 126110 MGI: 88071 HomoloGene: 1261 GeneCards: ARNT
Шаблон експресії
PBB GE ARNT 218222 x at fs.png

PBB GE ARNT 218221 at fs.png

PBB GE ARNT 210828 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001037737
NM_009709
RefSeq (білок)
NP_001032826
NP_033839
Локус (UCSC) Хр. 1: 150.81 – 150.88 Mb Хр. 3: 95.43 – 95.5 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARNT (англ. Aryl hydrocarbon receptor nuclear translocator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 789 амінокислот, а молекулярна маса — 86 636[4].

Послідовність амінокислот
1020304050
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFD
DDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERR
RRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST
DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQP
QSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQ
SSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFC
HPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY
SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLA
PRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFA
QDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQ
QVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA
QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wang G.L., Jiang B.-H., Rue E.A., Semenza G.L. (1995). Hypoxia-inducible factor 1 is a basic-helix-loop-helix-PAS heterodimer regulated by cellular O2 tension.. Proc. Natl. Acad. Sci. U.S.A. 92: 5510 — 5514.  PubMed DOI:10.1073/pnas.92.12.5510
  • Reyes H., Reisz-Porszasz S., Hankinson O. (1992). Identification of the Ah receptor nuclear translocator protein (Arnt) as a component of the DNA binding form of the Ah receptor.. Science 256: 1193 — 1195.  PubMed DOI:10.1126/science.256.5060.1193
  • Bacsi S.G., Hankinson O. (1996). Functional characterization of DNA-binding domains of the subunits of the heterodimeric aryl hydrocarbon receptor complex imputing novel and canonical basic helix-loop-helix protein-DNA interactions.. J. Biol. Chem. 271: 8843 — 8850.  PubMed DOI:10.1074/jbc.271.15.8843
  • Nguyen T.A., Hoivik D., Lee J.-E., Safe S. (1999). Interactions of nuclear receptor coactivator/corepressor proteins with the aryl hydrocarbon receptor complex.. Arch. Biochem. Biophys. 367: 250 — 257.  PubMed DOI:10.1006/abbi.1999.1282

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:700 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P27540 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]