RBL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RBL2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RBL2, P130, Rb2, retinoblastoma-like 2, RB transcriptional corepressor like 2
Зовнішні ІД OMIM: 180203 MGI: 105085 HomoloGene: 4098 GeneCards: RBL2
Шаблон експресії
PBB GE RBL2 212331 at fs.png

PBB GE RBL2 212332 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005611
NM_001323608
NM_001323609
NM_001323610
NM_001323611
NM_001282000
NM_001282001
NM_011250
RefSeq (білок)
NP_001310537
NP_001310538
NP_001310539
NP_001310540
NP_005602
NP_001268929
NP_001268930
NP_035380
Локус (UCSC) Хр. 16: 53.43 – 53.49 Mb Хр. 8: 91.07 – 91.12 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RBL2 (англ. RB transcriptional corepressor like 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 139 амінокислот, а молекулярна маса — 128 367[4].

Послідовність амінокислот
1020304050
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFD
ELCSRLNMDEAARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVP
TVSKGTVEGNYVSLTRILKCSEQSLIEFFNKMKKWEDMANLPPHFRERTE
RLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTVSEI
FHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNALQCSNRKELV
NPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDE
RIFLGEDAEEEIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRIS
TPLTGVRYIKENSPCVTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRT
CSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYY
KVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNF
PFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVR
ADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPP
QPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGI
ANENGGITFFPVQVNVGGQAQAVTGSIQPLSAQALAGSLSSQQVTGTTLQ
VPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFFRKVYHLAAVR
LRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQ
NSPTELNKDRTSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEE
ERGDLIQFYNNIYIKQIKTFAMKYSQANMDAPPLSPYPFVRTGSPRRIQL
SQNHPVYISPHKNETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTK
KRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH

Кодований геном білок за функціями належить до репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Li Y., Graham C., Lacy S., Duncan A.M.V., Whyte P. (1993). The adenovirus E1A-associated 130-kD protein is encoded by a member of the retinoblastoma gene family and physically interacts with cyclins A and E.. Genes Dev. 7: 2366 — 2377.  PubMed DOI:10.1101/gad.7.12a.2366
  • Hannon G.J., Demetrick D., Beach D. (1993). Isolation of the Rb-related p130 through its interaction with CDK2 and cyclins.. Genes Dev. 7: 2378 — 2391.  PubMed DOI:10.1101/gad.7.12a.2378
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Baldi A., Boccia V., Claudio P.P., de Luca A., Giordano A. (1996). Genomic structure of the human retinoblastoma-related Rb2/p130 gene.. Proc. Natl. Acad. Sci. U.S.A. 93: 4629 — 4632.  PubMed DOI:10.1073/pnas.93.10.4629
  • Canhoto A.J., Chestukhin A., Litovchick L., DeCaprio J.A. (2000). Phosphorylation of the retinoblastoma-related protein p130 in growth-arrested cells.. Oncogene 19: 5116 — 5122.  PubMed DOI:10.1038/sj.onc.1203893
  • Tedesco D., Lukas J., Reed S.I. (2002). The pRb-related protein p130 is regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCF(Skp2).. Genes Dev. 16: 2946 — 2957.  PubMed DOI:10.1101/gad.1011202

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9894 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q08999 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]