ZBTB7B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB7B
Ідентифікатори
Символи ZBTB7B, THPOK, ZBTB15, ZFP-67, ZFP67, ZNF857B, c-KROX, hcKROX, CKROX, zinc finger and BTB domain containing 7B
Зовнішні ІД OMIM: 607646 MGI: 102755 HomoloGene: 7605 GeneCards: ZBTB7B
Шаблон експресії
PBB GE ZBTB7B 205853 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001252406
NM_001256455
NM_009565
NM_001355206
NM_001355211
NM_001355212
RefSeq (білок)
NP_001239335
NP_001243384
NP_033591
NP_001342135
NP_001342140
NP_001342141
Локус (UCSC) Хр. 1: 155 – 155.02 Mb Хр. 3: 89.38 – 89.39 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB7B (англ. Zinc finger and BTB domain containing 7B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 539 амінокислот, а молекулярна маса — 58 027[4].

Послідовність амінокислот
1020304050
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRA
VLAACSHYFKKLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALG
ALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPS
PDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARR
SRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGP
GDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP
EELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPV
CHKIIHGAGKLPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGER
PYSCPHCPARFLHSYDLKNHMHLHTGDRPYECHLCHKAFAKEDHLQRHLK
GQNCLEVRTRRRRKDDAPPHYPPPSTAAASPAGLDLSNGHLDTFRLSLAR
FWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Widom R.L., Culic I., Lee J.Y., Korn J.H. (1997). Cloning and characterization of hcKrox, a transcriptional regulator of extracellular matrix gene expression.. Gene 198: 407 — 420.  PubMed DOI:10.1016/S0378-1119(97)00360-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18668 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, O15156 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]