ARHGAP35

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARHGAP35
Protein ARHGAP35 PDB 2K85.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARHGAP35, GRF-1, GRLF1, P190-A, P190A, p190ARhoGAP, p190RhoGAP, Rho GTPase activating protein 35
Зовнішні ІД OMIM: 605277 MGI: 1929494 HomoloGene: 35136 GeneCards: ARHGAP35
Шаблон експресії
PBB GE GRLF1 gnf1h03426 at fs.png

PBB GE GRLF1 202046 s at fs.png

PBB GE GRLF1 202044 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004491
NM_024342
NM_172739
RefSeq (білок)
NP_004482
NP_766327
Локус (UCSC) Хр. 19: 46.86 – 47.01 Mb Хр. 7: 16.49 – 16.61 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARHGAP35 (англ. Rho GTPase activating protein 35) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 499 амінокислот, а молекулярна маса — 170 514[4].

Послідовність амінокислот
1020304050
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEF
HLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFI
DDQTFQPHRSTALQPYIKRAAATKLASAEKLMYFCTDQLGLEQDFEQKQM
PDGKLLVDGFLLGIDVSRGMNRNFDDQLKFVSNLYNQLAKTKKPIVVVLT
KCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAFSTLVQLIDKS
RGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEA
LIPNLDEIDHLSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENE
RIPFDLMDTVPAEQLYEAHLEKLRNERKRVEMRRAFKENLETSPFITPGK
PWEEARSFIMNEDFYQWLEESVYMDIYGKHQKQIIDKAKEEFQELLLEYS
ELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAERDALILKHIHF
VYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNS
FQTPTFQPHGCLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTL
ILVNKRGDTSGETLHSLIQQGQQIASKLQCVFLDPASAGIGYGRNINEKQ
ISQVLKGLLDSKRNLNLVSSTASIKDLADVDLRIVMCLMCGDPFSADDIL
FPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSYHSSFSIRKSR
LVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEA
THMYDNAAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDT
SLPSLSKDHSKLSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPVHFE
ITKGDLSYLDQGHRDGQRKSVSSSPWLPQDGFDPSDYAEPMDAVVKPRNE
EENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDTSSLERGRKVS
IVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVP
LTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFD
QDHNLDLAEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDR
EQKLHALKEVLKKFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICF
WPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRPITEPPGARPS
SPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL

Кодований геном білок за функціями належить до репресорів, активаторів гтфаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних відростках.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Levay M., Settleman J., Ligeti E. (2009). Regulation of the substrate preference of p190RhoGAP by protein kinase C-mediated phosphorylation of a phospholipid binding site.. Biochemistry 48: 8615 — 8623.  PubMed DOI:10.1021/bi900667y
  • Bonet R., Ruiz L., Aragon E., Martin-Malpartida P., Macias M.J. (2009). NMR structural studies on human p190-A RhoGAPFF1 revealed that domain phosphorylation by the PDGF-receptor alpha requires its previous unfolding.. J. Mol. Biol. 389: 230 — 237.  PubMed DOI:10.1016/j.jmb.2009.04.035
  • LeClerc S., Palaniswami R., Xie B.X., Govindan M.V. (1991). Molecular cloning and characterization of a factor that binds the human glucocorticoid receptor gene and represses its expression.. J. Biol. Chem. 266: 17333 — 17340.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4591 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9NRY4 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]