RBL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RBL1
Ідентифікатори
Символи retinoblastoma-like protein 1RBL1p107retinoblastoma-like 1107 kDa retinoblastoma-associated proteinpRb1
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE RBL1 205296 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

RBL1 (англ. RB transcriptional corepressor like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 1 068 амінокислот, а молекулярна маса — 120 847[2].

Послідовність амінокислот
1020304050
MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYS
LEGEVTHWLACSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQ
FFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNP
YEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYH
LLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFTASEEPPCIIA
VLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQAN
VEYNLQQHFEKKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSI
VAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQP
GSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRS
LMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRD
MVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSS
PTAGSAKRRLFGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQ
TLLTMATAPVTGTTGHKVTIPLHGVANDAGEITLIPLSMNTNQESKVKSP
VSLTAHSLIGASPKQTNLTKAQEVHSTGINRPKRTGSLALFYRKVYHLAS
VRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYI
MAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYD
LANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRS
ALLYKFNGSPSKSLKDINNMIRQGEQRTKKRVIAIDSDAESPAKRVCQEN
DDVLLKRLQDVVSERANH

Кодований геном білок за функціями належить до репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, клітинний цикл, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ewen M.E., Xing Y., Lawrence J.B., Livingston D.M. (1991). Molecular cloning, chromosomal mapping, and expression of the cDNA for p107, a retinoblastoma gene product-related protein.. Cell 66: 1155 — 1164.  PubMed DOI:10.1016/0092-8674(91)90038-Z
  • Zhu L., Zhu L., Xie E., Chang L.S. (1995). Differential roles of two tandem E2F sites in repression of the human p107 promoter by retinoblastoma and p107 proteins.. Mol. Cell. Biol. 15: 3552 — 3562.  PubMed DOI:10.1128/MCB.15.7.3552
  • Leng X., Noble M., Adams P.D., Qin J., Harper J.W. (2002). Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4.. Mol. Cell. Biol. 22: 2242 — 2254.  PubMed DOI:10.1128/MCB.22.7.2242-2254.2002
  • Dyson N., Buchkovich K., Whyte P., Harlow E. (1989). The cellular 107K protein that binds to adenovirus E1A also associates with the large T antigens of SV40 and JC virus.. Cell 58: 249 — 255.  PubMed DOI:10.1016/0092-8674(89)90839-8
  • Kim Y.W., Otterson G.A., Kratzke R.A., Coxon A.B., Kaye F.J. (1994). Differential specificity for binding of retinoblastoma binding protein 2 to RB, p107, and TATA-binding protein.. Mol. Cell. Biol. 14: 7256 — 7264.  PubMed DOI:10.1128/MCB.14.11.7256

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:9893 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P28749 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]