YBX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
YBX3
Protein CSDA PDB 1h95.png
Ідентифікатори
Символи YBX3, CSDA, CSDA1, DBPA, ZONAB, Y-box binding protein 3
Зовнішні ІД OMIM: 603437 MGI: 2137670 HomoloGene: 2708 GeneCards: YBX3
Шаблон експресії
PBB GE CSDA 201160 s at fs.png

PBB GE CSDA 201161 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001145426
NM_003651
NM_011733
NM_139117
RefSeq (білок)
NP_001138898
NP_003642
NP_035863
NP_620817
Локус (UCSC) Хр. 12: 10.7 – 10.72 Mb Хр. 6: 131.36 – 131.39 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

YBX3 (англ. Y-box binding protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 372 амінокислот, а молекулярна маса — 40 090[4].

Послідовність амінокислот
1020304050
MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAA
HVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNV
RNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEK
GAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEG
SGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRS
RVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR
PAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK
EAKAGEAPTENPAPPTQQSSAE

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Sakura H., Maekawa T., Imamoto F., Yasuda K., Ishii S. (1988). Two human genes isolated by a novel method encode DNA-binding proteins containing a common region of homology.. Gene 73: 499 — 507.  PubMed DOI:10.1016/0378-1119(88)90514-8
  • Kudo S., Mattei M.-G., Fukuda M. (1995). Characterization of the gene for dbpA, a family member of the nucleic-acid-binding proteins containing a cold-shock domain.. Eur. J. Biochem. 231: 72 — 82.  PubMed DOI:10.1111/j.1432-1033.1995.tb20672.x
  • Coles L.S., Diamond P., Occhiodoro F., Vadas M.A., Shannon M.F. (1996). Cold shock domain proteins repress transcription from the GM-CSF promoter.. Nucleic Acids Res. 24: 2311 — 2317.  PubMed DOI:10.1093/nar/24.12.2311
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2428 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P16989 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]